PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009794536.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 192aa    MW: 22423.8 Da    PI: 6.2446
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009794536.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.21.5e-1285134554
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                     +++rr+ +NRe+ArrsR RK+  ++eL   v  L +eN+ L ++l++ ++
  XP_009794536.1  85 RKQRRMVSNRESARRSRMRKQRHLDELWSQVLRLRTENQNLMNKLNQVTE 134
                     79****************************************99999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.6E-1581145IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.34683146IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.5E-1085136No hitNo description
SuperFamilySSF579592.81E-1285135No hitNo description
PfamPF001701.4E-1085135IPR004827Basic-leucine zipper domain
CDDcd147021.25E-1886137No hitNo description
PROSITE patternPS00036088103IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MISSEAAAIH YFAPENNPSS FPTDFGFMHK NLPAFQYNTF LTNNNIQNYQ ASFPVQDFSQ  60
QPSCISSNST SDESEEQQIR VIDERKQRRM VSNRESARRS RMRKQRHLDE LWSQVLRLRT  120
ENQNLMNKLN QVTESHDRVI QENMQLKEEA SDLRRMITDI QIDSPFHAFS DFDEVTCNTA  180
HLKAESSNQS TK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
197104RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009794536.11e-141PREDICTED: basic leucine zipper 43-like
RefseqXP_013733616.11e-141PREDICTED: basic leucine zipper 43-like
RefseqXP_016478391.11e-141PREDICTED: basic leucine zipper 43-like
TrEMBLA0A068TW221e-90A0A068TW22_COFCA; Uncharacterized protein
STRINGSolyc04g005170.1.12e-85(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.13e-48basic leucine-zipper 42